Anti-aging

Many people consider preventing skin aging one of their most essential needs. Over the years, the cosmetic industry has strengthened this wish with new formulations and active ingredients. Consumers highly appreciate good looks and well-being.

Active anti-aging ingredients are participating in both directions. The tests on human volunteers demonstrated the positive influence of many modern ingredients and complexes against skin aging.

The active support of energy control in the cells and the prevention of DNA damage are essential steps to counteract the process of accelerated aging, often induced by UV light. The specific combinations of anti-aging ingredients and complexes do even more.

Strong regenerative effects, like stimulating collagen, support the consumer's need for well-being, resulting in improved skin elasticity and wrinkle reduction. The more consumers learn from the concepts and claims of cosmetic products containing anti-aging ingredients, the higher their expectations are. This section fulfills the increasing requirements of quickly learning consumers.

sh-Nonapeptide-4 is a synthetic recombinant peptide known under the trade name Clodessine, a fragment of the human Klotho protein that activates different Fibroblast Growth Factors (FGF) and is related to longevity. Klotho is considered to be an anti-aging factor.

sh-Oligopeptide-1 is a synthetic recombinant analog of human polypeptide EGF (Epidermal Growth Factor), which contains 53 amino acids with the sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR.

sh-Oligopeptide-2 is a synthetic single-chain (7.6 kDa) polypeptide hormone analog structurally similar to proinsulin, an Insulin-like Growth Factor (IGF-1) naturally synthesized by fibroblast cells.

sh-Oligopeptide-4 is a synthetic recombinant Thymosin-β4 peptide that helps strengthen hair while stimulating hair follicles to produce healthier hair.

sh-Oligopeptide-85 SP is a synthetic human recombinant peptide that has the sequence Gly-Phe-Ile-Asn-Leu-Asp-Lys-Pro-Ser-Asn-Pro corresponding to the part of the TruB domain of the human Dyskerin (89-100) protein.

sh-Pentapeptide-6 Trifluoroacetate synthetic recombinant peptide that boosts stratifin protein production improving bio-messaging between skin layers (epidermal-dermal "cross-talk") and leading to dermal remodeling and wrinkle repair.

sh-Polypeptide-1 is a single-chain synthetic peptide (molecular weight 17.25 kDa) analog of bFGF (basic Fibroblast Growth Factor or FGF2), that regulates skin renewal promotion.

sh-Polypeptide-10 is a synthetic recombinant single-chain peptide, an analog of human Fibroblast Growth Factor 10 (FGF10) that is involved in normal skin growth, regeneration, and wound repair.

sh-Polypeptide-11 (former rh-Oligopeptide-13; rh-Polypeptide-11) is a single-chain synthetic recombinant analog of acidic Fibroblast Growth

sh-Polypeptide-121 is a synthetic single-chain recombinant peptide derived from human collagen type 21 (also called collagen alpha-1 and encoded by the COL21A1 gene). It is known under the trade name HumaColl™21.

sh-Polypeptide-19 (former rh-Oligopeptide-3 and rh-Polypeptide-19) is a synthetic single-chain recombinant peptide, an analog of human TGF-α (Transforming Growth Factor-α). TGF-α boosts the generation and migration of keratinocytes, accelerates wound healing, and improves skin tone.

sh-Polypeptide-2 is a synthetic recombinant analog of human Thioredoxin (TRX) that stimulates dermal cell growth and proliferation and protects them from oxidative stress. Thioredoxin is a natural cytoprotector peptide present in all human cells.

sh-Polypeptide-3 (former rh-Oligopeptide-5) is a single-chain synthetic recombinant peptide, an analog of human KGF (Keratinocyte Growth Factor). KGF was first described in 1989 as a human growth factor that stimulated epithelial cell proliferation.

sh-Polypeptide-4 is a synthetic recombinant analog of human SCF (Stem Cell Factor, Mast Cell Growth Factor, or Kit ligand), a peptide of up to 273 amino acids.

sh-Polypeptide-5 is a synthetic recombinant peptide, an analog of human TGFβ3 (Transforming Growth Factor β3). It regulates the proliferation, growth, and differentiation of skin cells as a potent, multifunctional cytokine, and helps keep the skin young by converting old cells into new ones.

sh-Polypeptide-50 is a single-chain synthetic recombinant peptide that repeats the amino acid sequence of Tropoelastin, a protein produced inside fibroblasts.

sh-Polypeptide-62 is a synthetic recombinant peptide, an analog of human Hepatocyte Growth Factor (HGF). It stimulates keratin production, hair growth, and hair pigmentation, and accelerates wound healing and skin regeneration.

sh-Polypeptide-64 is a synthetic recombinant peptide derived from the human Aquaporin-1 (AQP-1) protein that promotes the transport of water across biological membranes.

sh-Polypeptide-7 is a synthetic recombinant analog of human growth hormone (hGH), also called Somatotropin. It repeats the amino acid sequences of hGH and mimics its action, stimulating the growth, reproduction, and regeneration of skin cells.

sh-Polypeptide-8 is a synthetic single-chain recombinant analog of human PDGF (Platelet-Derived Growth Factor) that is involved in normal skin growth, healing, and wound repair. rh-PDGF mimics the biological activity of the endogenous protein and is the active ingredient in several FDA-appro

sh-Polypeptide-9 is a synthetic recombinant analog of human VEGFA (Vascular Endothelial Growth Factor A). It enhances cell division and migration by increasing the permeability of capillary vessels to serum proteins.

sh-Polypeptide-93 is a synthetic recombinant human connective tissue growth factor (CTGF) analog peptide composed of 324 amino acids. It mimics the Insulin-like Growth Factor (IGF)-binding domain of CTGF and regulates the expression of genes responsible for collagen production in fibroblasts.

Shorea Stenoptera Seed Butter is obtained from the fruit of the Sal tree (Shorea Robusta). The butter is extracted, further processed, and refined from its fruit to obtain a light-colored yellow butter with a low odor and smooth texture suitable for cosmetics and toiletries.

Silk tree extract is also known as Albizia Julibrissin bark extract has antioxidant, anti-aging, and immunostimulating properties, thus used in many skincare formulations.
SK-influx® is a skin-identical lipid (ceramide) complex ingredient that restores the skin's protective barrier function. It is a concentrated formulation consisting of a multi-lamellar (membrane) system resembling the structure of the lipid barrier in the Stratum Corneum.
The use of small-molecule hyaluronic acid ensures that moisture is stored in the skin for a long time.
A rich source of polysaccharides, Snow Mushroom binds moisture to skin’s surface for a smoother, softer feel, while combating free radicals, diminishing age spots and naturally brightening the skin.

Sodium DNA is a sodium salt of deoxyribonucleic acid, a biologically active natural polymer that increases cell proliferation and activity.

Sodium Hyaluronate is the sodium salt form of Hyaluronic Acid (HA). It has been used in cosmetics and skincare products for moisturization and wound healing.

Soy Isoflavones are soybean-derived isoflavones in their active form as aglycones.