In our dermis, the lower structural layer of the skin mainly lies the distinction between youth and senescence. The alteration in such dermal architecture causes the major and most significant visible changes between young and aged skin.
Anti-aging
Many people consider preventing skin aging one of their most essential needs. Over the years, the cosmetic industry has strengthened this wish with new formulations and active ingredients. Consumers highly appreciate good looks and well-being.
Active anti-aging ingredients are participating in both directions. The tests on human volunteers demonstrated the positive influence of many modern ingredients and complexes against skin aging.
The active support of energy control in the cells and the prevention of DNA damage are essential steps to counteract the process of accelerated aging, often induced by UV light. The specific combinations of anti-aging ingredients and complexes do even more.
Strong regenerative effects, like stimulating collagen, support the consumer's need for well-being, resulting in improved skin elasticity and wrinkle reduction. The more consumers learn from the concepts and claims of cosmetic products containing anti-aging ingredients, the higher their expectations are. This section fulfills the increasing requirements of quickly learning consumers.Renovage™ made to extend the skin's youth span and works on the origin of youth and targets the cell actors which guarantee lifespan and youth. The age that we attribute to a face is a global assessment unconsciously based on several visual signs that are additive.
Reticap is a polymeric microencapsulated retinol specifically designed to keep its activity due to the stability enhancement in its formulation. This complex is a stable aqueous dispersion.
Retinol 15 D is a vitamin complex, yellow oil that may crystallize at temperatures below 0 °C; approx. 15 % solution of retinol in caprylic/capric triglyceride stabilized with BHT. It is miscible with fats and oils.
Retinyl Acetate is a vitamin A ester with acetic acid, an active ingredient for skin and oral care applications. It is an oily yellow liquid at room temperature (it may contain some crystals of vitamin A acetate) with a mild odor.
Retinyl Palmitate/Carrot Polypeptide is an ingredient known under the trade name Vitazyme™ A. It is a retinyl palmitate polypeptide conjugate, where retinyl palmitate bonded covalently with a natural polypeptide derived from a carrot.
RetiStar™ is a stabilized retinol in an oily dispersion. Traditionally, retinol in formulation requires the use of inert gas technology during manufacturing and packaging for its stability.
Revital-Eyes is a specialized botanical complex for eye care applications with anti-aging, anti-wrinkle, anti-dark circles, and undereye bag effects. It is a balanced formula with four active ingredients: probiotics, Green tea, and Pomegranate extracts, and Caffeine.
Rhodiola rosea, also known as Arctic root or Golden root, is a member of the Crassulaceae family, a family of plants native to the Arctic regions of Eastern Siberia and grows at high altitudes.
It is thought that the Greeks first brought the rose from Greece to southern Italy. They believed the red rose came from the blood of the goddess Aphrodite, whose foot got stuck in a thorn while trying to help Adonis.
Rosa Damascena Flower Water is a clear, transparent liquid with an adorable rose odor. Thanks to its soothing and anti-inflammatory properties, Damask rose water significantly decreases edema by inhibiting the mediators of inflammation.
Royal Jelly Extract is a light-to-medium amber liquid with a characteristic odor that contains essential nutrients and biologically active substances like 10-hydroxydecanoic acid, royalisin, and apisin.
Royal jelly is a mixture containing proteins, sugars, fatty acids, and B vitamins as well as antibacterial and antibiotic agents. In 2011, Japanese scientists discovered that royal jelly's effect on the evolution of bee larvae was due to a protein called Royalactin.
The extracellular matrix of human skin is comprised of collagen, elastic fibers (of which elastin is a major component), and basement membrane-associated macromolecules such as proteoglycans, fibronectin, and laminin.
Saccharomyces/Selenium Ferment is a biotechnological ingredient derived from the fermentation of living yeast cells in a Selenium ion-containing medium. It is a mineral-glycopeptides complex known under the trade name Acqua-Biomin® Selenium Y3.
Saccharomyces/Zinc Ferment is a biotechnological ingredient derived from the fermentation of living yeast cells in a zinc ion-containing medium. It is a mineral-glycopeptides complex known under the trade name the Acqua-Biomin® Zinc Y3.
Schisandra Chinensis Fruit Extract is a yellow to orange, oily liquid derived from Chinese berry grapes that restores the firmness of aged skin. It focuses on stimulating the synthesis of collagen XVII and Ladinin-1, boosting skin cohesion.
Schizophyllan is a natural β-glucan polysaccharide produced by the mushroom Schizophyllan Commune. It is used in anti-aging, sun care, and products for mature skin, thanks to its antioxidant, anti-photoaging, and skin whitening properties.
SensAmone P5 is a peptide-based complex ingredient inspired by nature under the sea.
Serilesine® is a peptide-based ingredient with a double anti-aging action on a cellular level. It contains a peptide called Hexapeptide-10, derived from a Laminin part responsible for adhesion. The amino acid sequence of Hexapeptide-10 is Ser-Asp-Gly-Pro-Arg-Pro.
sh-Nonapeptide-4 is a synthetic recombinant peptide known under the trade name Clodessine, a fragment of the human Klotho protein that activates different Fibroblast Growth Factors (FGF) and is related to longevity. Klotho is considered to be an anti-aging factor.
sh-Oligopeptide-1 is a synthetic recombinant analog of human polypeptide EGF (Epidermal Growth Factor), which contains 53 amino acids with the sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR.
sh-Oligopeptide-2 is a synthetic single-chain (7.6 kDa) polypeptide hormone analog structurally similar to proinsulin, an Insulin-like Growth Factor (IGF-1) naturally synthesized by fibroblast cells.
sh-Oligopeptide-4 is a synthetic recombinant Thymosin-β4 peptide that helps strengthen hair while stimulating hair follicles to produce healthier hair.