Anti-aging

Many people consider preventing skin aging one of their most essential needs. Over the years, the cosmetic industry has strengthened this wish with new formulations and active ingredients. Consumers highly appreciate good looks and well-being.

Active anti-aging ingredients are participating in both directions. The tests on human volunteers demonstrated the positive influence of many modern ingredients and complexes against skin aging.

The active support of energy control in the cells and the prevention of DNA damage are essential steps to counteract the process of accelerated aging, often induced by UV light. The specific combinations of anti-aging ingredients and complexes do even more.

Strong regenerative effects, like stimulating collagen, support the consumer's need for well-being, resulting in improved skin elasticity and wrinkle reduction. The more consumers learn from the concepts and claims of cosmetic products containing anti-aging ingredients, the higher their expectations are. This section fulfills the increasing requirements of quickly learning consumers.

Retinol 15 D is a vitamin complex, yellow oil that may crystallize at temperatures below 0 °C; approx. 15 % solution of retinol in caprylic/capric triglyceride stabilized with BHT. It is miscible with fats and oils.

Retinyl Acetate is a vitamin A ester with acetic acid, an active ingredient for skin and oral care applications. It is an oily yellow liquid at room temperature (it may contain some crystals of vitamin A acetate) with a mild odor.

Retinyl Palmitate is a stable form of vitamin A that acts as a skin normalizer, this nutrient helps remind the cells of what they "did" when they were young. In addition, it nourishes the skin when applied topically.

Retinyl Palmitate/Carrot Polypeptide is an ingredient known under the trade name Vitazyme™ A. It is a retinyl palmitate polypeptide conjugate, where retinyl palmitate bonded covalently with a natural polypeptide derived from a carrot.

RetiStar™ is a stabilized retinol in an oily dispersion. Traditionally, retinol in formulation requires the use of inert gas technology during manufacturing and packaging for its stability.

Revital Eyes is a specialized botanical complex for eye care applications with anti-aging, anti-wrinkle, anti-dark circles, and undereye bag effects. It is a balanced formula with four active ingredients: probiotics, Green tea and Pomegranate extracts, and Caffeine.

Rhodiola rosea, also known as Arctic root or Golden root, is a member of the Crassulaceae family, a family of plants native to the Arctic regions of Eastern Siberia and grows at high altitudes.

Rooibos (Aspalathus Linearis) leafs wild-harvested in the Cederberg region (a small area in South Africa) are potent antioxidants, high in polyphenols and rich in minerals.

It is thought that the Greeks first brought the rose from Greece to southern Italy. They believed the red rose came from the blood of the goddess Aphrodite, whose foot got stuck in a thorn while trying to help Adonis.

Rosa Canina oil softens skin and is high in essential fatty acids. It helps to reduce the appearance of fine lines and wrinkles and repairs damaged skin.

Rosa Damascena Flower Water is a clear, transparent liquid with an adorable rose odor. Thanks to its soothing and anti-inflammatory properties, Damask rose water significantly decreases edema by inhibiting the mediators of inflammation.

Rosa Moschata is a cell rejuvenator, and rose is appropriate for all complexion types, including sun-damaged and couperose skin. It reduces the signs of aging and makes skin smoother, moistened, feel, and look more youthful.

The milky-white gelatinous substance of Royal Jelly is secreted in the salivary glands of worker bees for the sole purpose of stimulating the growth and development of queen bees.

Royal jelly is a mixture containing proteins, sugars, fatty acids, and B vitamins as well as antibacterial and antibiotic agents. In 2011, Japanese scientists discovered that royal jelly's effect on the evolution of bee larvae was due to a protein called Royalactin.

The extracellular matrix of human skin is comprised of collagen, elastic fibers (of which elastin is a major component), and basement membrane-associated macromolecules such as proteoglycans, fibronectin, and laminin.

Saccharomyces/Selenium Ferment is a biotechnological ingredient derived from the fermentation of living yeast cells in a Selenium ion-containing medium. It is a mineral-glycopeptides complex known under the trade name the Acqua-Biomin® Selenium Y3.

Saccharomyces/Zinc Ferment is a biotechnological ingredient derived from the fermentation of living yeast cells in a zinc ion-containing medium. It is a mineral-glycopeptides complex known under the trade name the Acqua-Biomin® Zinc Y3.

Schisandra Chinensis Fruit Extract is a yellow to orange, oily liquid derived from Chinese berry grapes that restores the firmness of aged skin. It focuses on stimulating the synthesis of collagen XVII and Ladinin-1, boosting skin cohesion.

Schizophyllan is a natural polysaccharide derived from mushroom bio-fermentation. It is used in anti-aging, suncare, and products designed for mature skin.

The root extract of this medicinal plant contains more than 40 bioactive compounds, including flavonoids, terpenoids, polysaccharides, and essential oil with volatile components.

SensAmone P5 is a peptide-based complex ingredient inspired by nature under the sea.

Serilesine® is a peptide-based ingredient with a double anti-aging action on a cellular level. It contains a peptide called Hexapeptide-10, derived from a Laminin part responsible for adhesion. The amino acid sequence of Hexapeptide-10 is Ser-Asp-Gly-Pro-Arg-Pro.

sh-Nonapeptide-4 is a synthetic recombinant peptide known under the trade name Clodessine, a fragment of human Klotho protein that activates different Fibroblasts Growth Fatrors (FGF) and is related to lognitivity. Klotho is considered to be an anti-aging factor.

sh-Oligopeptide-1 is a synthetic recombinant analog of human polypeptide EGF (Epidermal Growth Factor), which contains 53 amino acids with the sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR.

sh-Oligopeptide-2 is a synthetic single-chain (7.6 kDa) polypeptide hormone analog structurally similar to proinsulin, an Insulin-like Growth Factor (IGF-1) naturally synthesized by fibroblast cells.

sh-Oligopeptide-4 is a synthetic recombinant Thymosin-β4 peptide that helps strengthen hair while stimulating hair follicles to produce healthier hair.

sh-Oligopeptide-85 is a synthetic recombinant peptide, an analog of human Dyskerin involved in stabilizing to RNA molecules and ribosome biogenesis regulation.

sh-Pentapeptide-6 Trifluoroacetate synthetic recombinant peptide that boosts stratifin protein production improving bio-messaging between skin layers (epidermal-dermal "cross-talk") and leading to dermal remodeling and wrinkle repair.

sh-Polypeptide-1 is a single-chain synthetic peptide (molecular weight 17.25 kDa) hormone bFGF (basic Fibroblast Growth Factor) that regulates skin's renewal promotional subtraction It is also an essential constituent for maintaining the best condition of the body as this is concerned with restor

sh-Polypeptide-10 is a synthetic recombinant single-chain peptide, an analog of human Fibroblast Growth Factor 10 (FGF10) that is involved in normal skin growth, regeneration, and wound repair.