sh-Polypeptide-10 is a synthetic recombinant single-chain peptide, an analog of human Fibroblast Growth Factor 10 (FGF10) that is involved in normal skin growth, regeneration, and wound repair. After UV exposure, dermal cells produce FGF10, which provides a protective effect against UV-induced skin damage, increasing epidermal thickness and promoting keratinocyte proliferation.
Boosting fibroblast growth, sh-Polypeptide-10 promotes collagen and elastin production, exposing a firmer, lifted, and rejuvenated appearance of the skin. It smooths fine lines and wrinkles and helps prevent their future formation.
Studies using hair root sheath and dermal papilla cells showed that FGF10 increases nuclear β-catenin levels, thereby promoting cell proliferation and migration. It encourages hair follicle development, making sh-Polypeptide-10 helpful for anti-hair loss and other hair care applications.
Encapsulated in Lactic Acid/Glycolic Acid Copolymer (PLGA) microcapsules, recombinant FGF10 accelerates wound healing by stimulating the generation of new dermal cells and improving skin renewal. sh-Polypeptide-10 is a safe, effective, and compatible ingredient for advanced anti-aging applications for skin, hair, and body care.
Synonyms
rh-Polypeptide-10
CG-FGF-10
Human Oligopeptide-12
rh-Oligopeptide-12
Changed
References
Fibroblast growth factor 10 protects against UVB-induced skin injury by activating the ERK/YAP signalling pathway
Author(s):
Wang N, Dong Y, Xu X, Shen Y, Huang Z, Yu Y, Liu Z, Gong W, Zhang S, Zheng Y, Song Y, Zhu Z, Jin L, Cong W
PMID:
35851701
DOI:
10.1111/cpr.13315
Topical Application of Fibroblast Growth Factor 10-PLGA Microsphere Accelerates Wound Healing via Inhibition of ER Stress
Author(s):
Xu K, Chai B, Zhang K, Xiong J, Zhu Y, Xu J, An N, Xia W, Ji H, Wu Y, Li H, Xiao J, Feng Z, Zhang H
PMID:
33354279
DOI:
10.1155/2020/8586314
Balance between fibroblast growth factor 10 and secreted frizzled-relate protein-1 controls the development of hair follicle by competitively regulating β-catenin signaling
Author(s):
Zhang H, Nan W, Wang S, Si H, Li G
PMID:
29864939
DOI:
10.1016/j.biopha.2018.04.149
Fibroblast growth factors stimulate hair growth through β-catenin and Shh expression in C57BL/6 mice
Author(s):
Lin WH, Xiang LJ, Shi HX, Zhang J, Jiang LP, Cai PT, Lin ZL, Lin BB, Huang Y, Zhang HL, Fu XB, Guo DJ, Li XK, Wang XJ, Xiao J
PMID:
25685806
DOI:
10.1155/2015/730139
Fibroblast growth factors: key players in epithelial morphogenesis, repair and cytoprotection
Author(s):
Steiling H, Werner S
PMID:
14580585
DOI:
10.1016/j.copbio.2003.08.003
Human fibroblast growth factor 10 expression in dermal papilla cells, outer root sheath cells and keratinocytes
sh-Oligopeptide-4 is a synthetic recombinant Thymosin-β4 peptide that helps strengthen hair while stimulating hair follicles to produce healthier hair.
Decapeptide-4 is a synthetic peptide known under the trade name CG-IDP2 that mimics the Somatomedin C (IGF-1) growth factor involved in normal skin growth, healing, and wound repair.
Although hair disorders are not life-threatening, their profound impact on social interaction and on patients' psychological aspects is undeniable. The demand for hair loss treatment has led to a multibillion-dollar industry.
Bio-Placenta is a complex composed of synthetic growth factors (mimicking peptide placental growth factors), vitamins, amino acid derivatives, and hyaluronic acid encapsulated in Lecithin nanoparticles that simulate dermal cell growth and proliferation, accelerating skin regeneration and renewal.
Acetyl Octapeptide-17 Amide is a synthetic peptide that mimics a functional part of EGF (Epidermal Growth Factor) with the sequence Ac-Met-Leu-Lys-Glu-Trp-Glu-Leu-Arg-NH2. It is known under the trade names Dermacurin and Mini EGF.
sh-Polypeptide-8 is a synthetic single-chain recombinant analog of human PDGF (Platelet-Derived Growth Factor) that is involved in normal skin growth, healing, and wound repair. rh-PDGF mimics the biological activity of the endogenous protein and is the active ingredient in several FDA-appro
sh-Polypeptide-93 is a synthetic recombinant human connective tissue growth factor (CTGF) analog peptide composed of 324 amino acids. It mimics the Insulin-like Growth Factor (IGF)-binding domain of CTGF and regulates the expression of genes responsible for collagen production in fibroblasts.
sh-Oligopeptide-1 is a synthetic recombinant analog of human polypeptide EGF (Epidermal Growth Factor), which contains 53 amino acids with the sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR.
sh-Oligopeptide-2 is a synthetic single-chain (7.6 kDa) polypeptide hormone analog structurally similar to proinsulin, an Insulin-like Growth Factor (IGF-1) naturally synthesized by fibroblast cells.
sh-Polypeptide-19 (former rh-Oligopeptide-3 and rh-Polypeptide-19) is a synthetic single-chain recombinant peptide, an analog of human TGF-α (Transforming Growth Factor-α). TGF-α boosts the generation and migration of keratinocytes, accelerates wound healing, and improves skin tone.
