sh-Polypeptide-3 (former rh-Oligopeptide-5) is a single-chain synthetic recombinant peptide, an analog of human KGF (Keratinocyte Growth Factor). KGF was first described in 1989 as a human growth factor that stimulated epithelial cell proliferation.
sh-Polypeptide-3 affects the proliferation and differentiation of various cell types, as it is a part of the heparin-binding fibroblast growth factor (FGF) superfamily, FGF7. KGF is involved in early hair growth as an essential go-between.
sh-Polypeptide-3 promotes dermal cell adhesion, spreading, and proliferation, and boosts regenerative processes in the skin and wound healing. It is an essential mediator in epithelial repairs and mesenchymal interactions. It is used in medicine to treat the adverse effects of radiotherapy on the skin or the oral cavity.
In addition, sh-Polypeptide-3 strengthens hair follicles, stimulating hair growth and enhancing their mechanical properties, health, and appearance. The former designation was rh-Polypeptide-3 (rh- prefix means recombinant human).
Synonyms
Recombinant Human Keratinocyte Growth Factor
CG-KGF
rh-Polypeptide-3
Human Oligopeptide-5
rh-Oligopeptide-5
Fibroblast Growth Factor 7
Palifermin
Changed
References
Keratinocyte growth factor
Author(s):
Rubin JS, Bottaro DP, Chedid M, Miki T, Ron D, Cheon G, Taylor WG, Fortney E, Sakata H, Finch PW
PMID:
7640656
DOI:
10.1006/cbir.1995.1085
Effect of tumour-cell-derived or recombinant keratinocyte growth factor (KGF) on proliferation and radioresponse of human epithelial tumour cells (HNSCC) and normal keratinocytes in vitro
Author(s):
Hille A, Grüger S, Christiansen H, Wolff HA, Volkmer B, Lehmann J, Dörr W, Rave-Fränk M
PMID:
20213138
DOI:
10.1007/s00411-010-0271-7
Palifermin: in myelotoxic therapy-induced oral mucositis
Author(s):
Siddiqui MA, Wellington K
PMID:
16225371
DOI:
10.2165/00003495-200565150-00008
Non-viral liposomal keratinocyte growth factor (KGF) cDNA gene transfer improves dermal and epidermal regeneration through stimulation of epithelial and mesenchymal factors
sh-Oligopeptide-4 is a synthetic recombinant Thymosin-β4 peptide that helps strengthen hair while stimulating hair follicles to produce healthier hair.
sh-Polypeptide-10 is a synthetic recombinant single-chain peptide, an analog of human Fibroblast Growth Factor 10 (FGF10) that is involved in normal skin growth, regeneration, and wound repair.
Decapeptide-4 is a synthetic peptide known under the trade name CG-IDP2 that mimics the Somatomedin C (IGF-1) growth factor involved in normal skin growth, healing, and wound repair.
Bio-Placenta is a complex composed of synthetic growth factors (mimicking peptide placental growth factors), vitamins, amino acid derivatives, and hyaluronic acid encapsulated in Lecithin nanoparticles that simulate dermal cell growth and proliferation, accelerating skin regeneration and renewal.
sh-Polypeptide-8 is a synthetic single-chain recombinant analog of human PDGF (Platelet-Derived Growth Factor) that is involved in normal skin growth, healing, and wound repair. rh-PDGF mimics the biological activity of the endogenous protein and is the active ingredient in several FDA-appro
Acetyl Octapeptide-17 Amide is a synthetic peptide that mimics a functional part of EGF (Epidermal Growth Factor) with the sequence Ac-Met-Leu-Lys-Glu-Trp-Glu-Leu-Arg-NH2. It is known under the trade names Dermacurin and Mini EGF.
sh-Polypeptide-19 (former rh-Oligopeptide-3 and rh-Polypeptide-19) is a synthetic single-chain recombinant peptide, an analog of human TGF-α (Transforming Growth Factor-α). TGF-α boosts the generation and migration of keratinocytes, accelerates wound healing, and improves skin tone.
sh-Polypeptide-93 is a synthetic recombinant human connective tissue growth factor (CTGF) analog peptide composed of 324 amino acids. It mimics the Insulin-like Growth Factor (IGF)-binding domain of CTGF and regulates the expression of genes responsible for collagen production in fibroblasts.
sh-Oligopeptide-1 is a synthetic recombinant analog of human polypeptide EGF (Epidermal Growth Factor), which contains 53 amino acids with the sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR.
sh-Oligopeptide-2 is a synthetic single-chain (7.6 kDa) polypeptide hormone analog structurally similar to proinsulin, an Insulin-like Growth Factor (IGF-1) naturally synthesized by fibroblast cells.
Royal jelly is a mixture containing proteins, sugars, fatty acids, and B vitamins as well as antibacterial and antibiotic agents. In 2011, Japanese scientists discovered that royal jelly's effect on the evolution of bee larvae was due to a protein called Royalactin.
