Peptides

There are numerous examples in physiology of peptide regulatory elements that play integral roles in basic homeostatic mechanisms such as injury-repair responses and other stimulus-response actions. Among these are well-known neuropeptides (e.g., bradykinins, endorphins); metabolism and fat storage regulators (e.g., neuropeptide Y, leptin, insulin); tanning and skin pigmentation-related peptides (e.g., α-MSH, ACTH, Agouti), and peptides involved in wound healing (e.g., FGF).

This large group of innovative cosmeceutical ingredients triumphed in the world of skincare products during the last two decades. Peptides are chains of amino acids that are attached in a specific order. Amino acids are naturally occurring in the body and are vital to everyday living processes. Peptides can be made up of 2 or more amino acids that can stimulate different responses within the body. As a result, peptides serve as tiny messengers that can be sent to kick the skin into gear and make it look better.

Peptides are leading a beauty revolution due to their excellent multi-functional properties; formularies are scrambling to access the latest advances in cosmetic peptide technology. In addition, their "Botox-like" performance, activation of collagen and elastin production, and skin-lightening effect make them very efficient against coarse wrinkles and hyperpigmentation of the skin.

TFA-Val-Try-Val-OH

Progeline™ (Trifluoroacetyl Tripeptide-2; sequence: TFA-Val-Try-Val-OH) is a biomimetic peptide-based complex ingredient that mimics a specific protein Elafin responsible for the inhibition of the Elastase enzyme that breaks down elastin.

Quintescine; Cysteinylglycine

Quintescine™ IS is a peptide-based complex ingredient that mimics glutathione action leaving antioxidant, anti-glycation, and anti-aging effect on the skin.

Facial moisturizers, nutrient serums, and even daily cleansers claim to contain powerful ingredients that stave off the development of undesirable, yet seemingly inevitable, extrinsic signs of aging - from wrinkles to age spots to sagging skin.

Regestril before after

Several studies in the 90s showed that on the cellular level stretch marks formation process starts with endogenous glucocorticoid (corticosteroids) secretion under influence of stress or hormonal changes during puberty or pregnancy.

Renaissance before after

In our dermis, the lower structural layer of the skin mainly lies the distinction between youth and senescence. The alteration in such dermal architecture causes the major and most significant visible changes between young and aged skin.

rh-Polypeptide-13, also known under the trade name CG-Noggin (former designation Human Oligopeptide-18; rh-Oligopeptide-18), is a synthetic single-chain recombinant polypeptide that promotes hair growth while inhibiting its depigmentation.

Pentapeptide-48

Royal jelly is a mixture containing proteins, sugars, fatty acids, and B vitamins as well as antibacterial and antibiotic agents. In 2011, Japanese scientists discovered that royal jelly's effect on the evolution of bee larvae was due to a protein called Royalactin.

Sea snail

s-Mu-Conotoxin CnIIIC is a synthetic oligopeptide derived from one of the marine cone snails' toxins, also called conotoxins or conopeptides. μ-CnIIIC is a 22-amino-acid-length conotoxin polypeptide obtained from Conus consors, which exhibited muscle-relaxing properties in tests on rodents.

Pentapeptide-59

SensAmone P5 is a peptide-based complex ingredient inspired by nature under the sea.

Hexapeptide-10

Serilesine® is a peptide-based ingredient with a double anti-aging action on a cellular level. It contains a peptide called Hexapeptide-10, derived from a Laminin part responsible for adhesion. The amino acid sequence of Hexapeptide-10 is Ser-Asp-Gly-Pro-Arg-Pro.

sh-Nonapeptide-4 is a synthetic recombinant peptide known under the trade name Clodessine, a fragment of human Klotho protein that activates different Fibroblasts Growth Fatrors (FGF) and is related to lognitivity. Klotho is considered to be an anti-aging factor.

Epidermal Growth Factor

sh-Oligopeptide-1 is a synthetic recombinant analog of human polypeptide EGF (Epidermal Growth Factor), which contains 53 amino acids with the sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR.

sh-Oligopeptide-2 is a synthetic single chain (7.6 kDa) polypeptide hormone structurally similar to proinsulin, an Insulin-like Growth Factor (IGF-1) naturally synthesized in the liver and fibroblast cells.

sh-Oligopeptide-4 is a synthetic recombinant Thymosin-β4 peptide that helps strengthen hair while stimulating hair follicles to produce healthier hair.

sh-Oligopeptide-5 is an N-terminal fragment of human AIMP1 (ARS-interacting multi-functional protein 1).

sh-Oligopeptide-78 is a synthetic recombinant 123 amino acid long, biomimetic peptide, with a sequence corresponding to a part of Type II Keratin, which repeats several times in that structural protein. It is known under the trade name K18Peptide™.

sh-Oligopeptide-85 is a synthetic recombinant peptide, an analog of human Dyskerin involved in stabilizing to RNA molecules and ribosome biogenesis regulation.

thymopoietin

sh-Pentapeptide-1 (former designation: Pentapeptide-1) is a synthetic recombinant peptide derived from thymopoietin, a human hormone with immunomodulating properties.

sh-Pentapeptide-5 is a synthetic recombinant peptide that mimics endorphin action and leaves a Botox-like effect. This opioid peptide effectively reduces the appearance of expression lines and deep wrinkles exposing smoother, younger-looking, and healthy skin.

Neomatrix Before After

sh-Pentapeptide-6 Trifluoroacetate synthetic recombinant peptide that boosts stratifin protein production improving bio-messaging between skin layers (epidermal-dermal "cross-talk") and leading to dermal remodeling and wrinkle repair.

sh-Polypeptide-1 is a single-chain synthetic peptide (molecular weight 17.25 kDa) hormone bFGF (basic Fibroblast Growth Factor) that regulates skin's renewal promotional subtraction It is also an essential constituent for maintaining the best condition of the body as this is concerned with restor

Fibroblast Growth Factor 10 (FGF10)

sh-Polypeptide-10 is a synthetic recombinant single-chain peptide, an analog of human Fibroblast Growth Factor 10 (FGF10) that is involved in normal skin growth, regeneration, and wound repair.

sh-Polypeptide-11 (former rh-Oligopeptide-13; rh-Polypeptide-11) is known under the trade name CG-aFGF, a single-chain synthetic recombinant

sh-Polypeptide-12 is a synthetic recombinant single-chain peptide, an analog of human Interleukin 4 (IL-4), that acts as an antihistamine or immune-suppressor agent to reduce scratching by inhibiting the autoimmune response.

sh-Polypeptide-121 is a synthetic single-chain recombinant peptide derived from human collagen type 21 (also called collagen alpha-1 and encoded by the COL21A1 gene). It is known under the trade name HumaColl™21.

sh-Polypeptide-19 (former rh-Oligopeptide-3) is a synthetic single-chain recombinant peptide, an analog of human TGF-α (Transforming Growth Factor-α). It boosts new dermal cell generation improving skin tone that brimming with vitality & energy.

sh-Polypeptide-2 is a synthetic recombinant analog of human Thioredoxin (TRX) that stimulates dermal cell growth and proliferation and protects them from oxidative stress. Thioredoxin is a natural cytoprotector peptide present in all human cells.

sh-Polypeptide-22 is a synthetic recombinant human transforming growth factor beta 1 (TGFβ-1) analog peptide composed of 113 amino acids.

Besides lactation, human Prolactin is a hormone that regulates hair follicle cycles, angiogenesis, keratinocyte proliferation, and the activity of epithelial stem cells.

Keratinocyte Growth Factor; FGF7 - Fibroblast growth factor 7

sh-Polypeptide-3 (former rh-Oligopeptide-5) is a single-chain synthetic recombinant peptide, an analog of human KGF (Keratinocyte Growth Factor). KGF was first described in 1989 as a human growth factor that stimulated epithelial cell proliferation.