Peptides
There are numerous examples in physiology of peptide regulatory elements that play integral roles in basic homeostatic mechanisms such as injury-repair responses and other stimulus-response actions. Among these are well-known neuropeptides (e.g., bradykinins, endorphins); metabolism and fat storage regulators (e.g., neuropeptide Y, leptin, insulin); tanning and skin pigmentation-related peptides (e.g., α-MSH, ACTH, Agouti), and peptides involved in wound healing (e.g., FGF).
This large group of innovative cosmeceutical ingredients triumphed in the world of skincare products during the last two decades. Peptides are chains of amino acids that are attached in a specific order. Amino acids are naturally occurring in the body and are vital to everyday living processes. Peptides can be made up of 2 or more amino acids that can stimulate different responses within the body. As a result, peptides serve as tiny messengers that can be sent to kick the skin into gear and make it look better.
Peptides are leading a beauty revolution due to their excellent multi-functional properties; formularies are scrambling to access the latest advances in cosmetic peptide technology. In addition, their "Botox-like" performance, activation of collagen and elastin production, and skin-lightening effect make them very efficient against coarse wrinkles and hyperpigmentation of the skin.
Progeline™ (Trifluoroacetyl Tripeptide-2; sequence: TFA-Val-Try-Val-OH) is a biomimetic peptide-based complex ingredient that mimics a specific protein, Elafin, responsible for the inhibition of the Elastase enzyme that breaks down elastin.
Prolyl Hydroxyproline is a biologically active matrikine dipeptide with the sequence Pro-Hyp found in collagen hydrolysates.
Quintescine™ IS is a peptide-based complex ingredient that mimics glutathione action leaving antioxidant, anti-glycation, and anti-aging effect on the skin.
Several studies in the 90s showed that on the cellular level stretch marks formation process starts with endogenous glucocorticoid (corticosteroids) secretion under influence of stress or hormonal changes during puberty or pregnancy.
In our dermis, the lower structural layer of the skin mainly lies the distinction between youth and senescence. The alteration in such dermal architecture causes the major and most significant visible changes between young and aged skin.
rh-Polypeptide-13 (sh-Polypeptide-13), also known under the trade name CG-Noggin (former designation Human Oligopeptide-18; rh-Oligopeptide-18), is a synthetic single-chain recombinant polypeptide that promotes hair growth while inhibiting its depigmentation.
Royal jelly is a mixture containing proteins, sugars, fatty acids, and B vitamins as well as antibacterial and antibiotic agents. In 2011, Japanese scientists discovered that royal jelly's effect on the evolution of bee larvae was due to a protein called Royalactin.
s-Mu-Conotoxin CnIIIC is a synthetic oligopeptide derived from one of the marine cone snails' toxins, also called conotoxins or conopeptides. μ-CnIIIC is a 22-amino-acid-length conotoxin polypeptide obtained from Conus consors, which exhibited muscle-relaxing properties in tests on rodents.
Serilesine® is a peptide-based ingredient with a double anti-aging action on a cellular level. It contains a peptide called Hexapeptide-10, derived from a Laminin part responsible for adhesion. The amino acid sequence of Hexapeptide-10 is Ser-Asp-Gly-Pro-Arg-Pro.
sh-Nonapeptide-4 is a synthetic recombinant peptide known under the trade name Clodessine, a fragment of the human Klotho protein that activates different Fibroblast Growth Factors (FGF) and is related to longevity. Klotho is considered to be an anti-aging factor.
sh-Oligopeptide-1 is a synthetic recombinant analog of human polypeptide EGF (Epidermal Growth Factor), which contains 53 amino acids with the sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR.
sh-Oligopeptide-2 is a synthetic single-chain (7.6 kDa) polypeptide hormone analog structurally similar to proinsulin, an Insulin-like Growth Factor (IGF-1) naturally synthesized by fibroblast cells.
sh-Oligopeptide-4 is a synthetic recombinant Thymosin-β4 peptide that helps strengthen hair while stimulating hair follicles to produce healthier hair.
sh-Oligopeptide-78 is a synthetic recombinant 123 amino acid long, biomimetic peptide, with a sequence corresponding to a part of Type II Keratin, which repeats several times in that structural protein. It is known under the trade name K18Peptide™.
sh-Oligopeptide-85 is a synthetic recombinant peptide, an analog of human Dyskerin involved in stabilizing to RNA molecules and ribosome biogenesis regulation.
sh-Pentapeptide-1 (former designation: Pentapeptide-1) is a synthetic recombinant peptide derived from thymopoietin, a human hormone with immunomodulating properties.
sh-Pentapeptide-5 is a synthetic recombinant peptide, an analog of human Leu-Enkephalin that mimics endorphin action and leaves a Botox-like effect.
sh-Pentapeptide-6 Trifluoroacetate synthetic recombinant peptide that boosts stratifin protein production improving bio-messaging between skin layers (epidermal-dermal "cross-talk") and leading to dermal remodeling and wrinkle repair.
sh-Polypeptide-1 is a single-chain synthetic peptide (molecular weight 17.25 kDa) analog of bFGF (basic Fibroblast Growth Factor or FGF2), that regulates skin renewal promotion.
sh-Polypeptide-10 is a synthetic recombinant single-chain peptide, an analog of human Fibroblast Growth Factor 10 (FGF10) that is involved in normal skin growth, regeneration, and wound repair.
sh-Polypeptide-11 (former rh-Oligopeptide-13; rh-Polypeptide-11) is a single-chain synthetic recombinant analog of acidic Fibroblast Growth
sh-Polypeptide-12 is a synthetic recombinant single-chain peptide, an analog of human Interleukin 4 (IL-4), that acts as an antihistamine or immune-suppressor agent to reduce scratching by inhibiting the autoimmune response.
sh-Polypeptide-121 is a synthetic single-chain recombinant peptide derived from human collagen type 21 (also called collagen alpha-1 and encoded by the COL21A1 gene). It is known under the trade name HumaColl™21.
sh-Polypeptide-19 (former rh-Oligopeptide-3 and rh-Polypeptide-19) is a synthetic single-chain recombinant peptide, an analog of human TGF-α (Transforming Growth Factor-α). TGF-α boosts the generation and migration of keratinocytes, accelerates wound healing, and improves skin tone.
sh-Polypeptide-2 is a synthetic recombinant analog of human Thioredoxin (TRX) that stimulates dermal cell growth and proliferation and protects them from oxidative stress. Thioredoxin is a natural cytoprotector peptide present in all human cells.
sh-Polypeptide-22 is a synthetic recombinant human transforming growth factor beta 1 (TGFβ-1) analog peptide composed of 113 amino acids.