Punica Granatum Sterols is derived from pomegranate seed oil by first heat sterilizing it and then fractionating to isolate the fraction rich in sterols. It is a white to light yellow waxy paste with a characteristic odor.
Regeneration booster
Skin regeneration processes work well in young and healthy skin. However, external influences like stress, lack of sleep, and air-conditioned environments slow down the regeneration process.
Mature skin has a decreased regeneration speed due to a slower renewing time of skin cells. The renewing process slows down between the young adult age of 25 and adults over 40.
Regeneration boosters support and speed up the renewal processes. Measurable results can be detected by the increase in skin smoothness and elasticity based on the stimulation of collagen biosynthesis.
Some regeneration boosters activate cell functions, enhance collagen and other structural protein production, and improve the skin condition, thus counteracting the signs of mature skin.
Pyridoxine Dipalmitate (Vitamin B6 Dipalmitate) is a white or similar white crystal or crystalline powder; odorless. It can be easily dissolved in oil, slightly dissolved in ethanol by hot, and cannot be dissolved in water.
r-(Methionyl sh-Oligopeptide-85) is a synthetic human recombinant peptide, where the initial expression sequence was engineered by appending a methionine initiation codon to the sh‑Oligopeptide‑85 coding region.
Retinyl Acetate is a vitamin A ester with acetic acid, an active ingredient for skin and oral care applications. It is an oily yellow liquid at room temperature (it may contain some crystals of vitamin A acetate) with a mild odor.
Rosewood oil is a very sweet, woody-floral, spicy, fragrance. Rosewood (Aniba Rosaeodora) is a medium-sized, tropical, evergreen tree with a reddish bark and heartwood, bearing yellow flowers.
Royal jelly is a mixture containing proteins, sugars, fatty acids, and B vitamins as well as antibacterial and antibiotic agents. In 2011, Japanese scientists discovered that royal jelly's effect on the evolution of bee larvae was due to a protein called Royalactin.
The extracellular matrix of human skin is comprised of collagen, elastic fibers (of which elastin is a major component), and basement membrane-associated macromolecules such as proteoglycans, fibronectin, and laminin.
Saccharomyces/Zinc Ferment is a biotechnological ingredient derived from the fermentation of living yeast cells in a zinc ion-containing medium. It is a mineral-glycopeptides complex known under the trade name the Acqua-Biomin® Zinc Y3.
This Chinese plant, Chinese Red Root Salvia (Salvia Miltiorrhiza), not to be confused with the more common Salvia Officinalis or Sage herb, has been used to increase metabolism, immunity, and blood circulation, as well as to treat coronary heart disease and ulcers.
Schizophyllan is a natural β-glucan polysaccharide produced by the mushroom Schizophyllan Commune. It is used in anti-aging, sun care, and products for mature skin, thanks to its antioxidant, anti-photoaging, and skin whitening properties.
sh-Oligopeptide-1 is a synthetic recombinant analog of human polypeptide EGF (Epidermal Growth Factor), which contains 53 amino acids with the sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR.
sh-Oligopeptide-4 is a synthetic recombinant Thymosin-β4 peptide that helps strengthen hair while stimulating hair follicles to produce healthier hair.
sh-Oligopeptide-85 SP is a synthetic human recombinant peptide that has the sequence Gly-Phe-Ile-Asn-Leu-Asp-Lys-Pro-Ser-Asn-Pro corresponding to the part of the TruB domain of the human Dyskerin (89-100) protein.
sh-Pentapeptide-5 is a synthetic recombinant peptide, an analog of human Leu-Enkephalin that mimics endorphin action and leaves a Botox-like effect.
sh-Polypeptide-10 is a synthetic recombinant single-chain peptide, an analog of human Fibroblast Growth Factor 10 (FGF10) that is involved in normal skin growth, regeneration, and wound repair.
sh-Polypeptide-12 is a synthetic recombinant single-chain peptide, an analog of human Interleukin 4 (IL-4), that acts as an antihistamine or immune-suppressor agent to reduce scratching by inhibiting the autoimmune response.
sh-Polypeptide-19 (former rh-Oligopeptide-3 and rh-Polypeptide-19) is a synthetic single-chain recombinant peptide, an analog of human TGF-α (Transforming Growth Factor-α). TGF-α boosts the generation and migration of keratinocytes, accelerates wound healing, and improves skin tone.
sh-Polypeptide-22 is a synthetic recombinant human transforming growth factor beta 1 (TGFβ-1) analog peptide composed of 113 amino acids.
Besides lactation, human Prolactin is a hormone that regulates hair follicle cycles, angiogenesis, keratinocyte proliferation, and the activity of epithelial stem cells.
sh-Polypeptide-3 (former rh-Oligopeptide-5) is a single-chain synthetic recombinant peptide, an analog of human KGF (Keratinocyte Growth Factor). KGF was first described in 1989 as a human growth factor that stimulated epithelial cell proliferation.
sh-Polypeptide-31 is a synthetic recombinant peptide that mimics human Insulin-like Growth Factor-2 (IGF-2). The old designation was rh-Polypeptide-31 (rh- prefix means recombinant human). IGF-II promotes the proliferation and migration of dermal fibroblasts and enhances collagen production.
sh-Polypeptide-62 is a synthetic recombinant peptide, an analog of human Hepatocyte Growth Factor (HGF). It stimulates keratin production, hair growth, and hair pigmentation, and accelerates wound healing and skin regeneration.
sh-Polypeptide-71 (former sh-Polypeptide-65) is a synthetic recombinant human Vasoactive Intestinal Peptide or VIP composed of up to 170 amino acids. This biologically active peptide regulates vasodilation in skin tissue, soothes inflammation, and enhances angiogenesis.
sh-Polypeptide-8 is a synthetic single-chain recombinant analog of human PDGF (Platelet-Derived Growth Factor) that is involved in normal skin growth, healing, and wound repair. rh-PDGF mimics the biological activity of the endogenous protein and is the active ingredient in several FDA-appro