Regeneration booster

Skin regeneration processes work well in young and healthy skin. However, external influences like stress, lack of sleep, and air-conditioned environments slow down the regeneration process.

Mature skin has a decreased regeneration speed due to a slower renewing time of skin cells. The renewing process slows down between the young adult age of 25 and adults over 40.

Regeneration boosters support and speed up the renewal processes. Measurable results can be detected by the increase in skin smoothness and elasticity based on the stimulation of collagen biosynthesis.

Some regeneration boosters activate cell functions, enhance collagen and other structural protein production, and improve the skin condition, thus counteracting the signs of mature skin.
Sage leaf extract is an organic skincare ingredient and natural antioxidant. The leaves of the small evergreen perennial are used in organic skincare products for their tonic, astringent, and soothing properties.

This Chinese plant, Chinese Red Root Salvia (Salvia Miltiorrhiza), not to be confused with the more common Salvia Officinalis or Sage herb, has been used to increase metabolism, immunity, and blood circulation, as well as to treat coronary heart disease and ulcers.

Schizophyllan is a natural polysaccharide derived from mushroom bio-fermentation. It is used in anti-aging, suncare, and products designed for mature skin.

The root extract of this medicinal plant contains more than 40 bioactive compounds, including flavonoids, terpenoids, polysaccharides, and essential oil with volatile components.

sh-Oligopeptide-1 is a synthetic recombinant analog of human polypeptide EGF (Epidermal Growth Factor), which contains 53 amino acids with the sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR.

sh-Oligopeptide-4 is a synthetic recombinant Thymosin-β4 peptide that helps strengthen hair while stimulating hair follicles to produce healthier hair.

sh-Oligopeptide-85 is a synthetic recombinant peptide, an analog of human Dyskerin involved in stabilizing to RNA molecules and ribosome biogenesis regulation.

sh-Pentapeptide-5 is a synthetic recombinant peptide that mimics endorphin action and leaves a Botox-like effect. This opioid peptide effectively reduces the appearance of expression lines and deep wrinkles exposing smoother, younger-looking, and healthy skin.

sh-Polypeptide-10 is a synthetic recombinant single-chain peptide, an analog of human Fibroblast Growth Factor 10 (FGF10) that is involved in normal skin growth, regeneration, and wound repair.

sh-Polypeptide-19 (former rh-Oligopeptide-3) is a synthetic single-chain recombinant peptide, an analog of human TGF-α (Transforming Growth Factor-α). It boosts new dermal cell generation improving skin tone that brimming with vitality & energy.

sh-Polypeptide-22 is a synthetic recombinant human transforming growth factor beta 1 (TGFβ-1) analog peptide composed of 113 amino acids.

Besides lactation, human Prolactin is a hormone that regulates hair follicle cycles, angiogenesis, keratinocyte proliferation, and the activity of epithelial stem cells.

sh-Polypeptide-3 (former rh-Oligopeptide-5) is a single-chain synthetic recombinant peptide, an analog of human KGF (Keratinocyte Growth Factor). KGF was first described in 1989 as a human growth factor that stimulated epithelial cell proliferation.

sh-Polypeptide-31 is a synthetic recombinant peptide that mimics human Insulin-like Growth Factor-2 (IGF-2). The old designation was rh-Polypeptide-31 (rh- prefix means recombinant human).

sh-Polypeptide-62 is a synthetic recombinant peptide, an analog of human Hepatocyte Growth Factor (HGF). It stimulates keratin production, hair growth, and hair pigmentation, and accelerates wound healing and skin regeneration.

sh-Polypeptide-71 (former sh-Polypeptide-65) is a synthetic recombinant human vasoactive intestinal peptide or VIP composed of 28 amino acids. This biologically active peptide controls vasodilatation in skin tissue, soothes inflammation, and improves angiogenesis.

sh-Polypeptide-8 is a synthetic single-chain recombinant analog of human PDGF (Platelet-Derived Growth Factor) that is involved in normal skin growth, healing, and wound repair. rh-PDGF mimics the biological activity of the endogenous protein and is the active ingredient in several FDA-appro

sh-Polypeptide-93 is a synthetic recombinant human connective tissue growth factor (CTGF) analog peptide composed of 324 amino acids. It mimics an Insulin-like Growth Factor (IGF)-binding domain of CTGF regulating the expression of genes responsible for collagen production in fibroblasts.

Shikonin Seed Oil (Lithospermum Officinale Seed Oil) is cold-pressed from Gromwell seeds of both wild and cultivated plants from the Boraginaceae (Borage) family. It is known in the Chinese traditional medicine under the name Zi Cao.

Si-Matrix is a balanced combination of micro-silica in a delivery system as molecular film. It re-structures damaged tissues, giving a controlled tensor effect where silica is one of the key ingredients for skin regeneration and repair.

SK-influx® is a skin-identical lipid (ceramide) complex ingredient that restores the skin's protective barrier function. It is a concentrated formulation consisting of a multi-lamellar (membrane) system resembling the structure of the lipid barrier in the Stratum Corneum.

Slippery elm (Ulmus fulva) is a member of the Elm family (Ulmaceae). The tree is also called gray elm, Indian elm, moose elm, red elm, soft elm, and sweet elm. It is a medium-sized, deciduous tree of moderately fast growth growing to 50-80 feet tall. The trunk is dark brown to reddish brown.

Snail Secretion Filtrate is obtained from the secretion of the garden snail Helix aspersa (Müller). This snail species has existed for 600 million years and has adapted to extreme climatic conditions.

This particular Vitamin C derivative can be used to stimulate collagen repair thus diminishing some of the effects of photo aging. Sodium Ascorbyl Phosphate is also capable of replenishing Vitamin E’s antioxidant capacity.

Investigations on fragments of deoxyribonucleic acid (DNA) a biologically active functional ingredient, consisting of deoxyribonucleic acid extracted from the gonad tissue of male sturgeon, purified, depolymerized, and neutralized with sodium ions DNA-Na or Sodium DNA and studied.

The common sorrel extract is a natural remedy against spider veins thanks to an antiplatelet effect.
St. John’s wort extract is widely used to care for irritated and reddened skin against sunburn, erythema, and superficial burns thanks to its anti-inflammatory, healing, softening, soothing, and purifying properties.
Almond oil moisturises, alleviates irritations and re-hydrates (particularly in the case of dry and sensitive skin), contains an exceptionally high amount of simple and complex unsaturated fatty acids as well as numerous vitamins.

Sweet basil (Ocimum basilicum) oil is similar to a combination of cloves and anise. Ocimum basilicum essential oil is obtained by steam distillation from the flowering herb.

This anti-inflammatory herbal extract accelerates wound healing and stimulates skin cell growth. It is used to soothe skin and to promote healing in minor cuts, burns, and sunburns.