Oligopeptide-45

Ghochikyan Arthur

Oligopeptide-45

Functions

Anti-aging

Firming

Regeneration booster

Energizing agent

INCI name

Oligopeptide-45

Identifier

CIG-1531

Oligopeptide-45 is a synthetic biomimetic peptide that speeds up the development and proliferation of dermal keratinocytes and fibroblasts. It is also known under the trade name CG-Dermaheal.

Boosting the generation of new skin cells, Oligopeptide-45 lessens the appearance of fine lines and wrinkles additionally preventing new expression lines formation. It increases the energy potential of cells and improves the skin tone that is brim with, youthfulness, vitality, and radiance.

In addition, Oligopeptide-45 prevents and fights against blemishes and scars on the skin, exposing a fresher, flawless, and glowing appearance.

Synonyms

CG-Dermaheal

Changed

2026-02-14

Related ingredients

Oligopeptide-22

Oligopeptide-22 is a synthetic peptide with anti-wrinkle, anti-aging, and wound-healing properties. It is known under the trade name CG-IDP 3.

Oligopeptide-55

Oligopeptide-55 is a synthetic 12 amino acid long peptide that boosts keratinocytes and fibroblasts proliferation and collagen and elastin production improving skin elasticity and resilience. This peptide is also known under the trade name CG-Collagrin.

Heptapeptide-7

Heptapeptide-7 is a synthetic peptide with sequence Met-Gly-Arg-Asn-Ile-Arg-Asn, a fragment of a well-studied peptide HB-107 with wound-healing and anti-aging properties.

Acetyl Octapeptide-17 Amide

Acetyl Octapeptide-17 Amide is a synthetic peptide that mimics a functional part of EGF (Epidermal Growth Factor) with the sequence Ac-Met-Leu-Lys-Glu-Trp-Glu-Leu-Arg-NH2. It is known under the trade names Dermacurin and Mini EGF.

sh-Polypeptide-8

sh-Polypeptide-8 is a synthetic single-chain recombinant analog of human PDGF (Platelet-Derived Growth Factor) that is involved in normal skin growth, healing, and wound repair. rh-PDGF mimics the biological activity of the endogenous protein and is the active ingredient in several FDA-appro

Palmitoyl tripeptide-28

Palmitoyl tripeptide-28 is a peptide ingredient based on TGF-β (Transforming growth factor beta) that mimics cytokine action by binding with specific receptors (TGF beta receptor 2) on fibroblast membrane, stimulating the production of extracellular matrix (ECM) components.

sh-Polypeptide-93

sh-Polypeptide-93 is a synthetic recombinant human connective tissue growth factor (CTGF) analog peptide composed of 324 amino acids. It mimics the Insulin-like Growth Factor (IGF)-binding domain of CTGF and regulates the expression of genes responsible for collagen production in fibroblasts.

Octapeptide-11

Octapeptide-11 is a synthetic peptide with sequence Met-Ile-Pro-Cys-Tyr-Ile-Ser-Ser known under the trade name CG-Seperin. It acts as an inhibitor of the MMP (Matrix MetalloProteinase) enzyme responsible for hyaluronic acid degradation.

sh-Oligopeptide-1

sh-Oligopeptide-1 is a synthetic recombinant analog of human polypeptide EGF (Epidermal Growth Factor), which contains 53 amino acids with the sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR.

Palmitoyl Dipeptide-17

Palmitoyl Dipeptide-17 (Palmitoyl Glycylproline) is a synthetic lipopeptide with the sequence Pal-Gly-Pro. It is known under the trade name Proliphil.

Acetylarginyltryptophyl Diphenylglycine

Elastin, together with collagen, glycosaminoglycans, and other components of the extracellular matrix (ECM), promotes firmness, rigidity, elasticity, and mechanical support for the skin.

sh-Polypeptide-19

sh-Polypeptide-19 (former rh-Oligopeptide-3 and rh-Polypeptide-19) is a synthetic single-chain recombinant peptide, an analog of human TGF-α (Transforming Growth Factor-α). TGF-α boosts the generation and migration of keratinocytes, accelerates wound healing, and improves skin tone.